PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_25058A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 329aa    MW: 36338.4 Da    PI: 7.0897
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_25058AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.5e-161663148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg W++eEde+l++ + ++G g+W+++++  g+ R++k+c++rw +yl
  Oropetium_20150105_25058A 16 RGLWSPEEDEKLYNHIIRYGVGCWSSVPKLAGLERCGKSCRLRWINYL 63
                               788*******************************************97 PP

2Myb_DNA-binding49.59.6e-1669112146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                rg+++++E++l++ ++k lG++ W+ Ia+ ++ gRt++++k++w++
  Oropetium_20150105_25058A  69 RGSFSQQEEDLIISLHKILGNR-WSQIASQLP-GRTDNEIKNFWNS 112
                                899*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-231166IPR009057Homeodomain-like
PROSITE profilePS5129418.4041163IPR017930Myb domain
SuperFamilySSF466895.99E-2913110IPR009057Homeodomain-like
SMARTSM007176.8E-131565IPR001005SANT/Myb domain
PfamPF002492.6E-141663IPR001005SANT/Myb domain
CDDcd001671.07E-111963No hitNo description
PROSITE profilePS5129425.07364118IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-2567118IPR009057Homeodomain-like
SMARTSM007173.9E-1568116IPR001005SANT/Myb domain
PfamPF002492.6E-1469112IPR001005SANT/Myb domain
CDDcd001673.10E-1171111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGREAAAMTT RPKLRRGLWS PEEDEKLYNH IIRYGVGCWS SVPKLAGLER CGKSCRLRWI  60
NYLRPDLKRG SFSQQEEDLI ISLHKILGNR WSQIASQLPG RTDNEIKNFW NSCIKKKLRQ  120
RGIDPSTHKP LNEDAVAAEP NDECKQQPQH LPAIGAAAAG SSDNRLAPPH SPSAVSFDPL  180
SVTNVAAAAM QGSYGTGAAH SFRSDNLCDY GVSSDAGTYS AYTGGGDSSS NNSNSTWTXX  240
XXXXXXXXXX MPHMDIFARD MEPYAFDPAK FSSPWNNHPQ QHHHHHHHHD AGGAAASFPI  300
RSMSRDLPES CFDLARGALE DEFSIDFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-30121183108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794211e-148HF679421.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB15 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968898.11e-155PREDICTED: myb-related protein Hv33-like
RefseqXP_004968899.11e-155PREDICTED: myb-related protein Hv33-like
SwissprotP200275e-79MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A0A9AWX71e-159A0A0A9AWX7_ARUDO; Uncharacterized protein
STRINGSi002220m1e-155(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111643041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.15e-74myb domain protein 86